RNPS1 monoclonal antibody (M05), clone 7G8
  • RNPS1 monoclonal antibody (M05), clone 7G8

RNPS1 monoclonal antibody (M05), clone 7G8

Ref: AB-H00010921-M05
RNPS1 monoclonal antibody (M05), clone 7G8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RNPS1.
Información adicional
Size 100 ug
Gene Name RNPS1
Gene Alias E5.1|MGC117332
Gene Description RNA binding protein S1, serine-rich domain
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq PKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNPS1 (NP_006702, 158 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10921
Clone Number 7G8
Iso type IgG2a Kappa

Enviar uma mensagem


RNPS1 monoclonal antibody (M05), clone 7G8

RNPS1 monoclonal antibody (M05), clone 7G8