RNPS1 polyclonal antibody (A01)
  • RNPS1 polyclonal antibody (A01)

RNPS1 polyclonal antibody (A01)

Ref: AB-H00010921-A01
RNPS1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RNPS1.
Información adicional
Size 50 uL
Gene Name RNPS1
Gene Alias E5.1|MGC117332
Gene Description RNA binding protein S1, serine-rich domain
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNPS1 (NP_006702, 158 a.a. ~ 239 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10921

Enviar uma mensagem


RNPS1 polyclonal antibody (A01)

RNPS1 polyclonal antibody (A01)