GADD45G monoclonal antibody (M02), clone 1G10
  • GADD45G monoclonal antibody (M02), clone 1G10

GADD45G monoclonal antibody (M02), clone 1G10

Ref: AB-H00010912-M02
GADD45G monoclonal antibody (M02), clone 1G10

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant GADD45G.
Información adicional
Size 100 ug
Gene Name GADD45G
Gene Alias CR6|DDIT2|GADD45gamma|GRP17
Gene Description growth arrest and DNA-damage-inducible, gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GADD45G (AAH19325, 1 a.a. ~ 159 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10912
Clone Number 1G10
Iso type IgG2a Kappa

Enviar uma mensagem


GADD45G monoclonal antibody (M02), clone 1G10

GADD45G monoclonal antibody (M02), clone 1G10