BRD8 monoclonal antibody (M01), clone 3G8
  • BRD8 monoclonal antibody (M01), clone 3G8

BRD8 monoclonal antibody (M01), clone 3G8

Ref: AB-H00010902-M01
BRD8 monoclonal antibody (M01), clone 3G8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant BRD8.
Información adicional
Size 100 ug
Gene Name BRD8
Gene Alias SMAP|SMAP2|p120
Gene Description bromodomain containing 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,IF
Immunogen Prot. Seq RSGDQNWVSVSRAIKPFAEPGRPPDWFSQKHCASQYSELLETTETPKRKRGEKGEVVETVEDVIVRKLTAERVEELKKVIKETQERYRRLKRDAEL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BRD8 (NP_631938, 33 a.a. ~ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10902
Clone Number 3G8
Iso type IgG2b Kappa

Enviar uma mensagem


BRD8 monoclonal antibody (M01), clone 3G8

BRD8 monoclonal antibody (M01), clone 3G8