JTB purified MaxPab mouse polyclonal antibody (B01P)
  • JTB purified MaxPab mouse polyclonal antibody (B01P)

JTB purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010899-B01P
JTB purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human JTB protein.
Información adicional
Size 50 ug
Gene Name JTB
Gene Alias HJTB|HSPC222|PAR|hJT
Gene Description jumping translocation breakpoint
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLAGAGRPGLPQGRHLCWLLCAFTLKLCQAEAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRLFWKFEGAVVCVALIFACLVIIRQRQLDRKALEKVRKQIESI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen JTB (AAH00996, 1 a.a. ~ 146 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10899

Enviar uma mensagem


JTB purified MaxPab mouse polyclonal antibody (B01P)

JTB purified MaxPab mouse polyclonal antibody (B01P)