MALT1 MaxPab rabbit polyclonal antibody (D01)
  • MALT1 MaxPab rabbit polyclonal antibody (D01)

MALT1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00010892-D01
MALT1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MALT1 protein.
Información adicional
Size 100 uL
Gene Name MALT1
Gene Alias DKFZp434L132|MLT|MLT1
Gene Description mucosa associated lymphoid tissue lymphoma translocation gene 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP,IF
Immunogen Prot. Seq MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAELAGSRGRLRLSCLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESFQRSVDGVSESKLQICVEPTSQKLMPGSTLVLQCVAVGSPI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MALT1 (NP_776216.1, 1 a.a. ~ 813 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10892

Enviar uma mensagem


MALT1 MaxPab rabbit polyclonal antibody (D01)

MALT1 MaxPab rabbit polyclonal antibody (D01)