MALT1 polyclonal antibody (A01)
  • MALT1 polyclonal antibody (A01)

MALT1 polyclonal antibody (A01)

Ref: AB-H00010892-A01
MALT1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MALT1.
Información adicional
Size 50 uL
Gene Name MALT1
Gene Alias DKFZp434L132|MLT|MLT1
Gene Description mucosa associated lymphoid tissue lymphoma translocation gene 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EDTVEDKQEVNVGKPLIAKLDMHRGLGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPGNPSNVTPADSCHCSRTPDAFISSFAHHAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MALT1 (AAH30143, 685 a.a. ~ 784 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10892

Enviar uma mensagem


MALT1 polyclonal antibody (A01)

MALT1 polyclonal antibody (A01)