NMU purified MaxPab mouse polyclonal antibody (B01P)
  • NMU purified MaxPab mouse polyclonal antibody (B01P)

NMU purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010874-B01P
NMU purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NMU protein.
Información adicional
Size 50 ug
Gene Name NMU
Gene Alias -
Gene Description neuromedin U
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq CRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NMU (AAH12908, 36 a.a. ~ 174 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10874

Enviar uma mensagem


NMU purified MaxPab mouse polyclonal antibody (B01P)

NMU purified MaxPab mouse polyclonal antibody (B01P)