ARID5A purified MaxPab mouse polyclonal antibody (B01P)
  • ARID5A purified MaxPab mouse polyclonal antibody (B01P)

ARID5A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010865-B01P
ARID5A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ARID5A protein.
Información adicional
Size 50 ug
Gene Name ARID5A
Gene Alias MRF-1|MRF1|RP11-363D14
Gene Description AT rich interactive domain 5A (MRF1-like)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAKENRGDDGATERPKKAKEERRMDQMMPGKTKADAADPAPLPSQEPPRNSTEQQGLASGSSVSFVGASGCPEAYKRLLSSFYCKGTHGIMSPLAKKKLLAQVSKVEALQCQEEGCRHGAEPQASPAVHLPESPQSPKGLTENSRHRLTPQEGLQAPGGSLREEAQAGPCPAAPIFKGCFYTHPTEVLKPVSQHPRDFFSRLKDGVLLGPPGKEGLSVKEPQLVWGGDANRPSAFHKGGSRKGILYPKPKACWVS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ARID5A (AAH67301.1, 1 a.a. ~ 430 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10865

Enviar uma mensagem


ARID5A purified MaxPab mouse polyclonal antibody (B01P)

ARID5A purified MaxPab mouse polyclonal antibody (B01P)