C7orf16 monoclonal antibody (M01), clone 3E6
  • C7orf16 monoclonal antibody (M01), clone 3E6

C7orf16 monoclonal antibody (M01), clone 3E6

Ref: AB-H00010842-M01
C7orf16 monoclonal antibody (M01), clone 3E6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant C7orf16.
Información adicional
Size 100 ug
Gene Name C7orf16
Gene Alias GSBS
Gene Description chromosome 7 open reading frame 16
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MMSTEQMQPLELSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEHLIKRYDVQERHPKGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C7orf16 (NP_006649, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10842
Clone Number 3E6
Iso type IgG2a Kappa

Enviar uma mensagem


C7orf16 monoclonal antibody (M01), clone 3E6

C7orf16 monoclonal antibody (M01), clone 3E6