C7orf16 purified MaxPab rabbit polyclonal antibody (D01P)
  • C7orf16 purified MaxPab rabbit polyclonal antibody (D01P)

C7orf16 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010842-D01P
C7orf16 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human C7orf16 protein.
Información adicional
Size 100 ug
Gene Name C7orf16
Gene Alias GSBS
Gene Description chromosome 7 open reading frame 16
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MMSTEQMQPLEVSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMSPFAAGVTLLRDERPKAIVEDDEKDGDKIAI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C7orf16 (NP_006649.1, 1 a.a. ~ 155 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10842

Enviar uma mensagem


C7orf16 purified MaxPab rabbit polyclonal antibody (D01P)

C7orf16 purified MaxPab rabbit polyclonal antibody (D01P)