ALDH1L1 monoclonal antibody (M01J), clone 3E9
  • ALDH1L1 monoclonal antibody (M01J), clone 3E9

ALDH1L1 monoclonal antibody (M01J), clone 3E9

Ref: AB-H00010840-M01J
ALDH1L1 monoclonal antibody (M01J), clone 3E9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ALDH1L1.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 100 ug
Gene Name ALDH1L1
Gene Alias DKFZp781N0997|FTHFD
Gene Description aldehyde dehydrogenase 1 family, member L1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq EESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFEY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ALDH1L1 (NP_036322, 803 a.a. ~ 902 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10840
Clone Number 3000000000
Iso type IgG3 Kappa

Enviar uma mensagem


ALDH1L1 monoclonal antibody (M01J), clone 3E9

ALDH1L1 monoclonal antibody (M01J), clone 3E9