UTP14A MaxPab mouse polyclonal antibody (B01)
  • UTP14A MaxPab mouse polyclonal antibody (B01)

UTP14A MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00010813-B01
UTP14A MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human UTP14A protein.
Información adicional
Size 50 uL
Gene Name UTP14A
Gene Alias KIAA0266|NY-CO-16|SDCCAG16|dJ537K23.3
Gene Description UTP14, U3 small nucleolar ribonucleoprotein, homolog A (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MTANRLAESLLALSQQEELADLPKDYLLSESEDEGDNDGERKHQKLLEAISSLDGKNRRKLAERSEASLKVSEFNVSSEGSGEKLVLADLLEPVKTSSSLATVKKQLSRVKSKKTVELPLNKEEIERIHREVAFNKTAQVLSKWDPVVLKNRQAEQLVFPLEKEEPAIAPIEHVLSGWKARTPLEQEIFNLLHKNKQPVTDPLLTPVEKASLRAMSLEEAKMRRAELQRARALQSYYEAKARREKKIKSKKYHKV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UTP14A (NP_006640.2, 1 a.a. ~ 771 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10813

Enviar uma mensagem


UTP14A MaxPab mouse polyclonal antibody (B01)

UTP14A MaxPab mouse polyclonal antibody (B01)