NOXA1 purified MaxPab rabbit polyclonal antibody (D01P)
  • NOXA1 purified MaxPab rabbit polyclonal antibody (D01P)

NOXA1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010811-D01P
NOXA1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NOXA1 protein.
Información adicional
Size 100 ug
Gene Name NOXA1
Gene Alias FLJ25475|MGC131800|NY-CO-31|SDCCAG31|p51NOX
Gene Description NADPH oxidase activator 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASLGDLVRAWHLGAQAVDRGDWARALHLFSGVPAPPARLCFNAGCVHLLAGDPEAALRAFDQAVTKDTCMAVGFFQRGVANFQLARFQEALSDFWLALEQLRGHAAIDYTQLGLRFKLQAWEVLHNVASAQCQLGLWTEAASSLREAMSKWPEGSLNGLDSALDQVQRRGSLPPRQVPRGEVFRPHRWHLKHLEPVDFLGKAKVVASAIPDDQGWGVRPQQPQGPGANHDARSLIMDSPRAGTHQGPLDAETEV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NOXA1 (NP_006638.1, 1 a.a. ~ 483 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10811

Enviar uma mensagem


NOXA1 purified MaxPab rabbit polyclonal antibody (D01P)

NOXA1 purified MaxPab rabbit polyclonal antibody (D01P)