RPP40 monoclonal antibody (M03), clone 1G8
  • RPP40 monoclonal antibody (M03), clone 1G8

RPP40 monoclonal antibody (M03), clone 1G8

Ref: AB-H00010799-M03
RPP40 monoclonal antibody (M03), clone 1G8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RPP40.
Información adicional
Size 100 ug
Gene Name RPP40
Gene Alias RNASEP1|bA428J1.3
Gene Description ribonuclease P/MRP 40kDa subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,S-ELISA,ELISA
Immunogen Prot. Seq EHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKNEHGFRKGGEHLYNFVIFNNQDYWLQMAVGANDHCPP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPP40 (NP_006629, 295 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10799
Clone Number 1G8
Iso type IgG2b Kappa

Enviar uma mensagem


RPP40 monoclonal antibody (M03), clone 1G8

RPP40 monoclonal antibody (M03), clone 1G8