RPP40 polyclonal antibody (A01)
  • RPP40 polyclonal antibody (A01)

RPP40 polyclonal antibody (A01)

Ref: AB-H00010799-A01
RPP40 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RPP40.
Información adicional
Size 50 uL
Gene Name RPP40
Gene Alias RNASEP1|bA428J1.3
Gene Description ribonuclease P/MRP 40kDa subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKNEHGFRKGGEHLYNFVIFNNQDYWLQMAVGANDHCPP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPP40 (NP_006629, 295 a.a. ~ 363 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10799

Enviar uma mensagem


RPP40 polyclonal antibody (A01)

RPP40 polyclonal antibody (A01)