VAMP5 polyclonal antibody (A01)
  • VAMP5 polyclonal antibody (A01)

VAMP5 polyclonal antibody (A01)

Ref: AB-H00010791-A01
VAMP5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant VAMP5.
Información adicional
Size 50 uL
Gene Name VAMP5
Gene Alias -
Gene Description vesicle-associated membrane protein 5 (myobrevin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen VAMP5 (NP_006625, 1 a.a. ~ 70 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10791

Enviar uma mensagem


VAMP5 polyclonal antibody (A01)

VAMP5 polyclonal antibody (A01)