NEK6 monoclonal antibody (M02), clone 2A7
  • NEK6 monoclonal antibody (M02), clone 2A7

NEK6 monoclonal antibody (M02), clone 2A7

Ref: AB-H00010783-M02
NEK6 monoclonal antibody (M02), clone 2A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NEK6.
Información adicional
Size 50 ug
Gene Name NEK6
Gene Alias SID6-1512
Gene Description NIMA (never in mitosis gene a)-related kinase 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NEK6 (AAH00101, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10783
Clone Number 2A7
Iso type IgG2a Kappa

Enviar uma mensagem


NEK6 monoclonal antibody (M02), clone 2A7

NEK6 monoclonal antibody (M02), clone 2A7