NEK6 polyclonal antibody (A01)
  • NEK6 polyclonal antibody (A01)

NEK6 polyclonal antibody (A01)

Ref: AB-H00010783-A01
NEK6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NEK6.
Información adicional
Size 50 uL
Gene Name NEK6
Gene Alias SID6-1512
Gene Description NIMA (never in mitosis gene a)-related kinase 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq MAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NEK6 (AAH00101, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10783

Enviar uma mensagem


NEK6 polyclonal antibody (A01)

NEK6 polyclonal antibody (A01)