ZMYND11 purified MaxPab mouse polyclonal antibody (B01P)
  • ZMYND11 purified MaxPab mouse polyclonal antibody (B01P)

ZMYND11 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010771-B01P
ZMYND11 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZMYND11 protein.
Información adicional
Size 50 ug
Gene Name ZMYND11
Gene Alias BRAM1|BS69|MGC111056|RP11-486H9.1
Gene Description zinc finger, MYND domain containing 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZMYND11 (AAH91489, 1 a.a. ~ 508 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10771

Enviar uma mensagem


ZMYND11 purified MaxPab mouse polyclonal antibody (B01P)

ZMYND11 purified MaxPab mouse polyclonal antibody (B01P)