TRAF3IP2 monoclonal antibody (M01), clone 4A3
  • TRAF3IP2 monoclonal antibody (M01), clone 4A3

TRAF3IP2 monoclonal antibody (M01), clone 4A3

Ref: AB-H00010758-M01
TRAF3IP2 monoclonal antibody (M01), clone 4A3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRAF3IP2.
Información adicional
Size 100 ug
Gene Name TRAF3IP2
Gene Alias ACT1|C6orf2|C6orf4|C6orf5|C6orf6|CIKS|DKFZp586G0522|MGC3581
Gene Description TRAF3 interacting protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq LRDKTVMIIVAISPKYKQDVEGAESQLDEDEHGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILLRLLREEEYVAPPRGPLPTLQVVPL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRAF3IP2 (AAH02823, 451 a.a. ~ 565 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10758
Clone Number 4A3
Iso type IgG2a Kappa

Enviar uma mensagem


TRAF3IP2 monoclonal antibody (M01), clone 4A3

TRAF3IP2 monoclonal antibody (M01), clone 4A3