CAPN9 polyclonal antibody (A01)
  • CAPN9 polyclonal antibody (A01)

CAPN9 polyclonal antibody (A01)

Ref: AB-H00010753-A01
CAPN9 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CAPN9.
Información adicional
Size 50 uL
Gene Name CAPN9
Gene Alias GC36|nCL-4
Gene Description calpain 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYADEELQLDFDDFLNCLVRLENASRVFQALSTKNKEFIHLNINEFIHLTMNI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CAPN9 (NP_006606, 591 a.a. ~ 690 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10753

Enviar uma mensagem


CAPN9 polyclonal antibody (A01)

CAPN9 polyclonal antibody (A01)