CHL1 monoclonal antibody (M02), clone 2H5
  • CHL1 monoclonal antibody (M02), clone 2H5

CHL1 monoclonal antibody (M02), clone 2H5

Ref: AB-H00010752-M02
CHL1 monoclonal antibody (M02), clone 2H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CHL1.
Información adicional
Size 100 ug
Gene Name CHL1
Gene Alias CALL|FLJ44930|L1CAM2|MGC132578
Gene Description cell adhesion molecule with homology to L1CAM (close homolog of L1)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIEFIVPSVPKFPK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHL1 (NP_006605, 26 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10752
Clone Number 2H5
Iso type IgG2a Kappa

Enviar uma mensagem


CHL1 monoclonal antibody (M02), clone 2H5

CHL1 monoclonal antibody (M02), clone 2H5