KIF1C monoclonal antibody (M06), clone 1F12
  • KIF1C monoclonal antibody (M06), clone 1F12

KIF1C monoclonal antibody (M06), clone 1F12

Ref: AB-H00010749-M06
KIF1C monoclonal antibody (M06), clone 1F12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KIF1C.
Información adicional
Size 100 ug
Gene Name KIF1C
Gene Alias KIAA0706|LTXS1
Gene Description kinesin family member 1C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq QPPEEVTPHPATPARRPPSPRRSHHPRRNSLDGGGRSRGAGSAQPEPQHFQPKKHNSYPQPPQPYPAQRPPGPRYPPYTTPPRMRRQRSAPDLKESGAAV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KIF1C (NP_006603, 1004 a.a. ~ 1103 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10749
Clone Number 1F12
Iso type IgG1 Kappa

Enviar uma mensagem


KIF1C monoclonal antibody (M06), clone 1F12

KIF1C monoclonal antibody (M06), clone 1F12