KLRA1 monoclonal antibody (M01), clone 1H3
  • KLRA1 monoclonal antibody (M01), clone 1H3

KLRA1 monoclonal antibody (M01), clone 1H3

Ref: AB-H00010748-M01
KLRA1 monoclonal antibody (M01), clone 1H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KLRA1.
Información adicional
Size 100 ug
Gene Name KLRA1
Gene Alias KLRA#|LY49L|Ly-49L|Ly49|MGC126520|MGC126522
Gene Description killer cell lectin-like receptor subfamily A, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq VTNIFQCIQEKHQRQEILRNCSEKYIMQNDNYLKEQILTNKTLKYDVLKNSFQQKKELDSRLIQKNRCHRENEIVFKVLQNTGKFSEDHGSCCGVNCYYFTMQKKD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLRA1 (NP_006602, 66 a.a. ~ 171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10748
Clone Number 1H3
Iso type IgG2b Kappa

Enviar uma mensagem


KLRA1 monoclonal antibody (M01), clone 1H3

KLRA1 monoclonal antibody (M01), clone 1H3