MAP3K2 polyclonal antibody (A01)
  • MAP3K2 polyclonal antibody (A01)

MAP3K2 polyclonal antibody (A01)

Ref: AB-H00010746-A01
MAP3K2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MAP3K2.
Información adicional
Size 50 uL
Gene Name MAP3K2
Gene Alias MEKK2|MEKK2B
Gene Description mitogen-activated protein kinase kinase kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq HMKSLKILLVINGSTQATNLEPLPSLEDLDNTVFGAERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPESMEQM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAP3K2 (NP_006600, 111 a.a. ~ 200 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10746

Enviar uma mensagem


MAP3K2 polyclonal antibody (A01)

MAP3K2 polyclonal antibody (A01)