PHTF1 purified MaxPab mouse polyclonal antibody (B01P)
  • PHTF1 purified MaxPab mouse polyclonal antibody (B01P)

PHTF1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010745-B01P
PHTF1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PHTF1 protein.
Información adicional
Size 50 ug
Gene Name PHTF1
Gene Alias PHTF
Gene Description putative homeodomain transcription factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MASNERDAISWYQKKIGAYDQQIWEKSIEQTQIKGLKNKPKKMGHIKPDLIDVDLIRGSTFAKAKPEIPWTSLTRKGLVRVVFFPLFSNWWIQVTSLRIFVWLLLLYFMQVIAIVLYLMMPIVNISEVLGPLCLMLLMGTVHCQIVSTQITRPSGNNGNRRRRKLRKTVNGDGSRENGNNSSDKVRGIETLESVPIIGGFWETIFGNRIKRVKLISNKGTETDNDPSCVHPIIKRRQCRPEIRMWQTREKAKFSD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PHTF1 (AAH02447.1, 1 a.a. ~ 637 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10745

Enviar uma mensagem


PHTF1 purified MaxPab mouse polyclonal antibody (B01P)

PHTF1 purified MaxPab mouse polyclonal antibody (B01P)