RAI2 MaxPab mouse polyclonal antibody (B01)
  • RAI2 MaxPab mouse polyclonal antibody (B01)

RAI2 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00010742-B01
RAI2 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human RAI2 protein.
Información adicional
Size 50 uL
Gene Name RAI2
Gene Alias -
Gene Description retinoic acid induced 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDDLQSQNLSMDMTDSPPALANNRLENGMAQLITTEAWNINSTDLVKKALVTVPAPSILNPPAESQSGMALKVAATVLQPLCLGESPVVMPIHMQVEGSSAPELNPNGNATYVMTTQGPVQLPVVLEQHVFQHLNSPLVLPQEAPCSSSTIHNNLFQGAEDPEAQPQLLDLRIPSQPQEPTLPFEAVLQNLFPSQGTLGPPPCQPPPGYAPVPPQPFSSPLSPLVPPATLLVPYPVIVPLPVPVPIPIPIPVPQS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAI2 (NP_068557, 1 a.a. ~ 530 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10742

Enviar uma mensagem


RAI2 MaxPab mouse polyclonal antibody (B01)

RAI2 MaxPab mouse polyclonal antibody (B01)