RBBP9 monoclonal antibody (M01A), clone 2A11
  • RBBP9 monoclonal antibody (M01A), clone 2A11

RBBP9 monoclonal antibody (M01A), clone 2A11

Ref: AB-H00010741-M01A
RBBP9 monoclonal antibody (M01A), clone 2A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RBBP9.
Información adicional
Size 200 uL
Gene Name RBBP9
Gene Alias BOG|MGC9236|RBBP10
Gene Description retinoblastoma binding protein 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq THRVYAIVLVSAYTSDLGDENERASGYFTRPWQWEKIKANCPYIVQFGSTDDPFLPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKSLLKVP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RBBP9 (NP_006597, 87 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 10741
Clone Number 2A11
Iso type IgG2a Kappa

Enviar uma mensagem


RBBP9 monoclonal antibody (M01A), clone 2A11

RBBP9 monoclonal antibody (M01A), clone 2A11