MGEA5 polyclonal antibody (A01)
  • MGEA5 polyclonal antibody (A01)

MGEA5 polyclonal antibody (A01)

Ref: AB-H00010724-A01
MGEA5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MGEA5.
Información adicional
Size 50 uL
Gene Name MGEA5
Gene Alias FLJ11229|FLJ23355|KIAA0679|MEA5|NCOAT|OGA
Gene Description meningioma expressed antigen 5 (hyaluronidase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SFHEEQEVLPETFLANFPSLIKMDIHKKVTDPSVAKSMMACLLSSLKANGSRGAFCEVRPDDKRILEFYSKLGCFEIAKMEGFPKDVVILGRSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MGEA5 (NP_036347, 823 a.a. ~ 916 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10724

Enviar uma mensagem


MGEA5 polyclonal antibody (A01)

MGEA5 polyclonal antibody (A01)