TBR1 monoclonal antibody (M01), clone 3F6
  • TBR1 monoclonal antibody (M01), clone 3F6

TBR1 monoclonal antibody (M01), clone 3F6

Ref: AB-H00010716-M01
TBR1 monoclonal antibody (M01), clone 3F6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TBR1.
Información adicional
Size 100 ug
Gene Name TBR1
Gene Alias MGC141978|TES-56
Gene Description T-box, brain, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MQLEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFDGSAADRYLLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TBR1 (NP_006584, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10716
Clone Number 3F6
Iso type IgG2a Kappa

Enviar uma mensagem


TBR1 monoclonal antibody (M01), clone 3F6

TBR1 monoclonal antibody (M01), clone 3F6