USP39 monoclonal antibody (M07), clone 4G11
  • USP39 monoclonal antibody (M07), clone 4G11

USP39 monoclonal antibody (M07), clone 4G11

Ref: AB-H00010713-M07
USP39 monoclonal antibody (M07), clone 4G11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant USP39.
Información adicional
Size 100 ug
Gene Name USP39
Gene Alias CGI-21|HSPC332|MGC75069|SAD1|SNRNP65
Gene Description ubiquitin specific peptidase 39
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KNPTIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETNQQGA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP39 (NP_006581, 466 a.a. ~ 565 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10713
Clone Number 4G11
Iso type IgG2a Kappa

Enviar uma mensagem


USP39 monoclonal antibody (M07), clone 4G11

USP39 monoclonal antibody (M07), clone 4G11