USP39 polyclonal antibody (A01)
  • USP39 polyclonal antibody (A01)

USP39 polyclonal antibody (A01)

Ref: AB-H00010713-A01
USP39 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant USP39.
Información adicional
Size 50 uL
Gene Name USP39
Gene Alias CGI-21|HSPC332|MGC75069|SAD1|SNRNP65
Gene Description ubiquitin specific peptidase 39
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq KNPTIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETNQQGA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP39 (NP_006581, 466 a.a. ~ 565 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10713

Enviar uma mensagem


USP39 polyclonal antibody (A01)

USP39 polyclonal antibody (A01)