GNB5 polyclonal antibody (A01)
  • GNB5 polyclonal antibody (A01)

GNB5 polyclonal antibody (A01)

Ref: AB-H00010681-A01
GNB5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GNB5.
Información adicional
Size 50 uL
Gene Name GNB5
Gene Alias FLJ37457|FLJ43714|GB5
Gene Description guanine nucleotide binding protein (G protein), beta 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MCDQTFLVNVFGSCDKCFKQRALRPVFKKSQQLSYCSTCAEIMATEGLHENETLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEAL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GNB5 (NP_057278, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10681

Enviar uma mensagem


GNB5 polyclonal antibody (A01)

GNB5 polyclonal antibody (A01)