CSPG5 monoclonal antibody (M01), clone 5C11
  • CSPG5 monoclonal antibody (M01), clone 5C11

CSPG5 monoclonal antibody (M01), clone 5C11

Ref: AB-H00010675-M01
CSPG5 monoclonal antibody (M01), clone 5C11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CSPG5.
Información adicional
Size 100 ug
Gene Name CSPG5
Gene Alias MGC44034|NGC
Gene Description chondroitin sulfate proteoglycan 5 (neuroglycan C)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KKLYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIAEGSHPNDDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGGKGDQADLDVNCLQNNLT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CSPG5 (NP_006565, 445 a.a. ~ 539 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10675
Clone Number 5C11
Iso type IgG1 Kappa

Enviar uma mensagem


CSPG5 monoclonal antibody (M01), clone 5C11

CSPG5 monoclonal antibody (M01), clone 5C11