GNA13 polyclonal antibody (A01)
  • GNA13 polyclonal antibody (A01)

GNA13 polyclonal antibody (A01)

Ref: AB-H00010672-A01
GNA13 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant GNA13.
Información adicional
Size 50 uL
Gene Name GNA13
Gene Alias G13|MGC46138
Gene Description guanine nucleotide binding protein (G protein), alpha 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFLDNLDKLGEPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEFDQV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GNA13 (AAH36756, 1 a.a. ~ 377 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10672

Enviar uma mensagem


GNA13 polyclonal antibody (A01)

GNA13 polyclonal antibody (A01)