FARS2 purified MaxPab rabbit polyclonal antibody (D01P)
  • FARS2 purified MaxPab rabbit polyclonal antibody (D01P)

FARS2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010667-D01P
FARS2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FARS2 protein.
Información adicional
Size 100 ug
Gene Name FARS2
Gene Alias FARS1|HSPC320|PheRS|dJ520B18.2
Gene Description phenylalanyl-tRNA synthetase 2, mitochondrial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVGSALRRGAHAYVYLVSKASHISRGHQHQAWGSRPPAAECATQRAPGSVVELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQYVGRFGTPLFSVYDNLSPVVTTWQNFDSLLIPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLHAGLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLFSKHELFAGIKDGESLQLFEQSSRSAHKQETHTMEAVKLVEFDLKQTLTRLMAHLF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FARS2 (NP_006558.1, 1 a.a. ~ 451 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10667

Enviar uma mensagem


FARS2 purified MaxPab rabbit polyclonal antibody (D01P)

FARS2 purified MaxPab rabbit polyclonal antibody (D01P)