LBX1 monoclonal antibody (M05), clone 3G6
  • LBX1 monoclonal antibody (M05), clone 3G6

LBX1 monoclonal antibody (M05), clone 3G6

Ref: AB-H00010660-M05
LBX1 monoclonal antibody (M05), clone 3G6

Información del producto

Mouse monoclonal antibody raised against a full length recombinant LBX1.
Información adicional
Size 100 ug
Gene Name LBX1
Gene Alias HPX-6|HPX6|LBX1H|homeobox
Gene Description ladybird homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LBX1 (NP_006553.2, 133 a.a. ~ 219 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10660
Clone Number 3G6
Iso type IgG2a Kappa

Enviar uma mensagem


LBX1 monoclonal antibody (M05), clone 3G6

LBX1 monoclonal antibody (M05), clone 3G6