KHDRBS1 monoclonal antibody (M03), clone 1A4
  • KHDRBS1 monoclonal antibody (M03), clone 1A4

KHDRBS1 monoclonal antibody (M03), clone 1A4

Ref: AB-H00010657-M03
KHDRBS1 monoclonal antibody (M03), clone 1A4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KHDRBS1.
Información adicional
Size 100 ug
Gene Name KHDRBS1
Gene Alias FLJ34027|Sam68|p62
Gene Description KH domain containing, RNA binding, signal transduction associated 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq ILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KHDRBS1 (AAH00717, 176 a.a. ~ 275 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10657
Clone Number 1A4
Iso type IgG2a Kappa

Enviar uma mensagem


KHDRBS1 monoclonal antibody (M03), clone 1A4

KHDRBS1 monoclonal antibody (M03), clone 1A4