KHDRBS1 MaxPab rabbit polyclonal antibody (D01)
  • KHDRBS1 MaxPab rabbit polyclonal antibody (D01)

KHDRBS1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00010657-D01
KHDRBS1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KHDRBS1 protein.
Información adicional
Size 100 uL
Gene Name KHDRBS1
Gene Alias FLJ34027|Sam68|p62
Gene Description KH domain containing, RNA binding, signal transduction associated 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPATQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KHDRBS1 (AAH10132.1, 1 a.a. ~ 381 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10657

Enviar uma mensagem


KHDRBS1 MaxPab rabbit polyclonal antibody (D01)

KHDRBS1 MaxPab rabbit polyclonal antibody (D01)