IGF2BP2 purified MaxPab rabbit polyclonal antibody (D01P)
  • IGF2BP2 purified MaxPab rabbit polyclonal antibody (D01P)

IGF2BP2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010644-D01P
IGF2BP2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IGF2BP2 protein.
Información adicional
Size 100 ug
Gene Name IGF2BP2
Gene Alias IMP-2|IMP2|VICKZ2|p62
Gene Description insulin-like growth factor 2 mRNA binding protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IGF2BP2 (AAH21290.1, 1 a.a. ~ 598 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10644

Enviar uma mensagem


IGF2BP2 purified MaxPab rabbit polyclonal antibody (D01P)

IGF2BP2 purified MaxPab rabbit polyclonal antibody (D01P)