TGOLN2 monoclonal antibody (M02), clone 2F11
  • TGOLN2 monoclonal antibody (M02), clone 2F11

TGOLN2 monoclonal antibody (M02), clone 2F11

Ref: AB-H00010618-M02
TGOLN2 monoclonal antibody (M02), clone 2F11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TGOLN2.
Información adicional
Size 100 ug
Gene Name TGOLN2
Gene Alias MGC14722|TGN38|TGN46|TGN48|TGN51|TTGN2
Gene Description trans-golgi network protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq QGPIDGPSKSGAEEQTSKDSPNKVVPEQPSRKDHSKPISNPSDNKELPKADTNQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TGOLN2 (NP_006455, 229 a.a. ~ 327 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10618
Clone Number 2F11
Iso type IgG2a Kappa

Enviar uma mensagem


TGOLN2 monoclonal antibody (M02), clone 2F11

TGOLN2 monoclonal antibody (M02), clone 2F11