STAMBP monoclonal antibody (M01), clone 1A8
  • STAMBP monoclonal antibody (M01), clone 1A8

STAMBP monoclonal antibody (M01), clone 1A8

Ref: AB-H00010617-M01
STAMBP monoclonal antibody (M01), clone 1A8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant STAMBP.
Información adicional
Size 100 ug
Gene Name STAMBP
Gene Alias AMSH|MGC126516|MGC126518
Gene Description STAM binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STAMBP (AAH65574, 1 a.a. ~ 424 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10617
Clone Number 1A8
Iso type IgG2a kappa

Enviar uma mensagem


STAMBP monoclonal antibody (M01), clone 1A8

STAMBP monoclonal antibody (M01), clone 1A8