SC65 purified MaxPab mouse polyclonal antibody (B01P)
  • SC65 purified MaxPab mouse polyclonal antibody (B01P)

SC65 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010609-B01P
SC65 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SC65 protein.
Información adicional
Size 50 ug
Gene Name SC65
Gene Alias NOL55
Gene Description synaptonemal complex protein SC65
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MARVAWGLLWLLLGSAGAQYEKYSFRGFPPEDLMPLAAAYGHALEQYEGESWRESARYLEAALRLHRLLRDSEAFCHANCSGPAPAAKPDPDGGRADEWACELRLFGRVLERAACLRRCKRTLPAFQVPYPPRQLLRDFQSRLPYQYLHYALFKANRLEKAVAAAYTFLQRNPKHELTAKYLNYYQGMLDVADESLTDLEAQPYEAVFLRAVKLYNSGDFRSSTEDMERALSEYLAVFARCLAGCEGAHEQVDFK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SC65 (NP_006446.1, 1 a.a. ~ 437 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10609

Enviar uma mensagem


SC65 purified MaxPab mouse polyclonal antibody (B01P)

SC65 purified MaxPab mouse polyclonal antibody (B01P)