PAICS purified MaxPab rabbit polyclonal antibody (D01P)
  • PAICS purified MaxPab rabbit polyclonal antibody (D01P)

PAICS purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010606-D01P
PAICS purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PAICS protein.
Información adicional
Size 100 ug
Gene Name PAICS
Gene Alias ADE2|ADE2H1|AIRC|DKFZp781N1372|MGC1343|MGC5024|PAIS
Gene Description phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAER
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PAICS (NP_006443.1, 1 a.a. ~ 425 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10606

Enviar uma mensagem


PAICS purified MaxPab rabbit polyclonal antibody (D01P)

PAICS purified MaxPab rabbit polyclonal antibody (D01P)