PAIP1 polyclonal antibody (A01)
  • PAIP1 polyclonal antibody (A01)

PAIP1 polyclonal antibody (A01)

Ref: AB-H00010605-A01
PAIP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PAIP1.
Información adicional
Size 50 uL
Gene Name PAIP1
Gene Alias MGC12360
Gene Description poly(A) binding protein interacting protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq YPTLSEYVQDFLNHLTEQPGSFETEIEQFAETLNGCVTTDDALQELVELIYQQATSIPNFSYMGARLCNYLSHHLTISPQSGNFRQLLLQRCRTEYEVKDQAAKGDEVTR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PAIP1 (NP_001002, 76 a.a. ~ 185 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10605

Enviar uma mensagem


PAIP1 polyclonal antibody (A01)

PAIP1 polyclonal antibody (A01)