CDC42EP3 purified MaxPab rabbit polyclonal antibody (D01P)
  • CDC42EP3 purified MaxPab rabbit polyclonal antibody (D01P)

CDC42EP3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010602-D01P
CDC42EP3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CDC42EP3 protein.
Información adicional
Size 100 ug
Gene Name CDC42EP3
Gene Alias BORG2|CEP3|FLJ46903|UB1
Gene Description CDC42 effector protein (Rho GTPase binding) 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAKLPRLSCEPVMEEKAQEKSSLLENGTVHQGDTSWGSSGSASQSSQGRDSHSSSLSEQYPDWPAEDMFDHPTPCELIKGKTKSEESLSDLTGSLLSLQLDLGPSLLDEVLNVMDKNK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CDC42EP3 (NP_006440.2, 1 a.a. ~ 254 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10602

Enviar uma mensagem


CDC42EP3 purified MaxPab rabbit polyclonal antibody (D01P)

CDC42EP3 purified MaxPab rabbit polyclonal antibody (D01P)