CDC42EP3 polyclonal antibody (A01)
  • CDC42EP3 polyclonal antibody (A01)

CDC42EP3 polyclonal antibody (A01)

Ref: AB-H00010602-A01
CDC42EP3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CDC42EP3.
Información adicional
Size 50 uL
Gene Name CDC42EP3
Gene Alias BORG2|CEP3|FLJ46903|UB1
Gene Description CDC42 effector protein (Rho GTPase binding) 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq IHIGKEGQHDVFGDISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAIS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDC42EP3 (NP_006440, 42 a.a. ~ 108 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10602

Enviar uma mensagem


CDC42EP3 polyclonal antibody (A01)

CDC42EP3 polyclonal antibody (A01)