GNLY purified MaxPab mouse polyclonal antibody (B01P)
  • GNLY purified MaxPab mouse polyclonal antibody (B01P)

GNLY purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010578-B01P
GNLY purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GNLY protein.
Información adicional
Size 50 ug
Gene Name GNLY
Gene Alias 519|D2S69E|LAG-2|LAG2|NKG5|TLA519
Gene Description granulysin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MATWALLLLAAMLLGNPGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GNLY (NP_006424.2, 1 a.a. ~ 145 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10578

Enviar uma mensagem


GNLY purified MaxPab mouse polyclonal antibody (B01P)

GNLY purified MaxPab mouse polyclonal antibody (B01P)