SIVA purified MaxPab mouse polyclonal antibody (B02P)
  • SIVA purified MaxPab mouse polyclonal antibody (B02P)

SIVA purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00010572-B02P
SIVA purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SIVA protein.
Información adicional
Size 50 ug
Gene Name SIVA1
Gene Alias CD27BP|SIVA|Siva-1|Siva-2
Gene Description SIVA1, apoptosis-inducing factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDEGCAVVHLPESPKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SIVA (NP_006418, 1 a.a. ~ 175 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10572

Enviar uma mensagem


SIVA purified MaxPab mouse polyclonal antibody (B02P)

SIVA purified MaxPab mouse polyclonal antibody (B02P)